SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000022351 from Anolis carolinensis 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000022351
Domain Number 1 Region: 7-143
Classification Level Classification E-value
Superfamily Cap-Gly domain 6.02e-34
Family Cap-Gly domain 0.00096
Further Details:      
 
Domain Number 2 Region: 132-370
Classification Level Classification E-value
Superfamily L domain-like 3.06e-28
Family Internalin LRR domain 0.039
Further Details:      
 
Domain Number 3 Region: 443-530
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.89e-22
Family Ubiquitin-related 0.0000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000022351   Gene: ENSACAG00000001489   Transcript: ENSACAT00000029768
Sequence length 530
Comment pep:known_by_projection chromosome:AnoCar2.0:1:219465333:219491754:-1 gene:ENSACAG00000001489 transcript:ENSACAT00000029768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSIPPNVIGRRVLCNGDYGTVLFVGSVPPTTGVWLGVEWDNPQRGKHNGSHEGIQYFK
CRHLSGGSFIRPNKANFGVDFLSAVREKYGLNEDQEDPESRTETSIVIGRRTVQTIGFDS
IKEKQKQLNNMSDISVDECAVSEAGQEEEIKRTCPNIRRINLSKNLLSSWNEVVNIACQL
EHLEILNVSKNKMKFPSTSLPSSRAFCNLKVLALNQTGVTWTEVLLCATGWPALEELYLA
SNEISLLERPIDTLHNLKWLNLSDNQLTDGNQLHLIADLPRLETLILSNNAISSIHFPDA
GFGCKTSKFPSLTHLGVKCNRIVEWSVINELDKLQNLHSLDCRNNPLMETDKNMETVKQL
LIAKIGQLNFLNKSAIFPEERRGAELDYRKKYGIDWLKAGGNQDPNKNNPSEEFLSAHPR
FQILCEKYGVPEDGELKKEQPFSLKNQLLALTFKCPDKPDQKPIEKKLPDSMTVQKVKGL
LYRLLKIPGSKLKLSYESSKMKGKEFELDNDLKPLQFYSIENEDCILVRW
Download sequence
Identical sequences R4GAP8
ENSACAP00000022351 XP_008122268.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]