SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|82701468|ref|YP_411034.1| from Nitrosospira multiformis ATCC 25196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82701468|ref|YP_411034.1|
Domain Number 1 Region: 163-347
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.36e-62
Family Methylesterase CheB, C-terminal domain 0.000025
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 3.84e-29
Family CheY-related 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|82701468|ref|YP_411034.1|
Sequence length 355
Comment response regulator receiver (CheY-like) modulated CheB methylesterase [Nitrosospira multiformis ATCC 25196]
Sequence
MINVLVVEDSPVVREFLIYILNSDPDITVIATAGDGEEAIDALRNHRPDVITMDIHMPKL
NGVEATQLIMETQPTPIVIVSGSTDPAEVGTTFDAIDAGALAVLPRPAGIGHPDHEATAR
KMIEVVKLMSEVKVVRRWARMRGASPASHSVRAPLLNRVAPARIVVVGASTGGPPALEAI
LSSLPKHFPVPILIVQHMTTGFMEGFVQWLKNSSNLPVHIARQGELPLPGHVYMAPDEYQ
MKVENRGEIVLTKDEPEHGSRPSISYLFRAVARVYGHDAVAGLLTGMGRDGADELRLLKE
KGAITFAQDKESSVVHGMAGEAIRLGAATMVLPLEKIAAALTNLVAERGETKLGA
Download sequence
Identical sequences A0A1H5RMD9 Q2YC79
WP_011379696.1.10075 NYSGXRC-11022d 323848.Nmul_A0334 gi|82701468|ref|YP_411034.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]