SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218768540|ref|YP_002343052.1| from Neisseria meningitidis Z2491

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218768540|ref|YP_002343052.1|
Domain Number 1 Region: 378-854
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 3.4e-143
Family Aconitase iron-sulfur domain 0.000000000000687
Further Details:      
 
Domain Number 2 Region: 162-370
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 5.49e-69
Family LeuD-like 0.0000000298
Further Details:      
 
Domain Number 3 Region: 1-159
Classification Level Classification E-value
Superfamily Aconitase B, N-terminal domain 1.23e-66
Family Aconitase B, N-terminal domain 0.000000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218768540|ref|YP_002343052.1|
Sequence length 861
Comment bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase [Neisseria meningitidis Z2491]
Sequence
MLEAYRKAAAERAALGIPALPLNAQQTADLVELLKSPPAGEGEFLVELLAHRVPPGVDDA
AKVKASFLAAVAEGSASSPLISPEYATELLGTMLGGYNIHALIELLDDDKLAPIAAKGLK
HTLLMFDSFHDVQEKAEKGNKYAQEVLQSWADAEWFASRAKVPEKITVTVFKVDGETNTD
DLSPAPDAWSRPDIPLHALAMLKNPRDGITPDKPGEVGPIKLLEELKAKGHPVAYVGDVV
GTGSSRKSATNSVIWHTGEDIPFVPNKRFGGVCLGGKIAPIFFNTQEDSGALPIEVDVSA
LKMGDVVDILPYEGKIVKNGETVAEFELKSQVLLDEVQAGGRINLIIGRGLTAKAREALK
LPASTAFRLPQAPAESKAGFTLAQKMVGRACGLPEGQGVRPGTYCEPRMTTVGSQDTTGP
MTRDELKDLACLGFSADMVMQSFCHTAAYPKPVDVKTHKELPAFISTRGGVSLRPGDGVI
HSWLNRLLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGVMPLDMPESVLVRFSGK
LQPGVTLRDLVNAIPLYAIKQGLLTVAKAGKKNIFSGRILEIEGLPDLKVEQAFELTDAS
AERSAAGCTVKLNKEPIIEYMKSNVVLMKNMIANGYQDPRTLERRIKAMEKWLANPELLE
ADKDAEYAAVIEINMDDIKEPIIACPNDPDDVCFMSERSGTKIDEVFIGSCMTNIGHFRA
ASKLLEGKADTPVRLWIAPPTKMDAKQLSDEGHYGVLGRAGARMEMPGCSLCMGNQAQVR
EGATVMSTSTRNFPNRLGKNTFVYLGSAELAAICSKLGKIPTVEEYQANIGIINEQGDKI
YRYMNFNEIDSYNEVAETVNV
Download sequence
Identical sequences A0A0U1RJM4 X5ERY7
gi|385338375|ref|YP_005892248.1| 122587.NMA1761 WP_002229716.1.100297 WP_002229716.1.100553 WP_002229716.1.100820 WP_002229716.1.101189 WP_002229716.1.101880 WP_002229716.1.101881 WP_002229716.1.10947 WP_002229716.1.11104 WP_002229716.1.13583 WP_002229716.1.13760 WP_002229716.1.14145 WP_002229716.1.14326 WP_002229716.1.14401 WP_002229716.1.15293 WP_002229716.1.16262 WP_002229716.1.17541 WP_002229716.1.17633 WP_002229716.1.17996 WP_002229716.1.18905 WP_002229716.1.18994 WP_002229716.1.19235 WP_002229716.1.19263 WP_002229716.1.19488 WP_002229716.1.19524 WP_002229716.1.20666 WP_002229716.1.20873 WP_002229716.1.21964 WP_002229716.1.23533 WP_002229716.1.23733 WP_002229716.1.24495 WP_002229716.1.24498 WP_002229716.1.24551 WP_002229716.1.24591 WP_002229716.1.26452 WP_002229716.1.26495 WP_002229716.1.26885 WP_002229716.1.2693 WP_002229716.1.27167 WP_002229716.1.27519 WP_002229716.1.28023 WP_002229716.1.28090 WP_002229716.1.28641 WP_002229716.1.29133 WP_002229716.1.29411 WP_002229716.1.29867 WP_002229716.1.30166 WP_002229716.1.30773 WP_002229716.1.3102 WP_002229716.1.32318 WP_002229716.1.32417 WP_002229716.1.32437 WP_002229716.1.32549 WP_002229716.1.32611 WP_002229716.1.34451 WP_002229716.1.36440 WP_002229716.1.37094 WP_002229716.1.37787 WP_002229716.1.38348 WP_002229716.1.39086 WP_002229716.1.39535 WP_002229716.1.40248 WP_002229716.1.40364 WP_002229716.1.40564 WP_002229716.1.40678 WP_002229716.1.40792 WP_002229716.1.40933 WP_002229716.1.41717 WP_002229716.1.42614 WP_002229716.1.43749 WP_002229716.1.43810 WP_002229716.1.44157 WP_002229716.1.44425 WP_002229716.1.44628 WP_002229716.1.44753 WP_002229716.1.450 WP_002229716.1.46137 WP_002229716.1.4873 WP_002229716.1.49387 WP_002229716.1.51761 WP_002229716.1.54176 WP_002229716.1.54577 WP_002229716.1.54816 WP_002229716.1.56376 WP_002229716.1.56511 WP_002229716.1.57270 WP_002229716.1.58184 WP_002229716.1.59880 WP_002229716.1.61206 WP_002229716.1.63651 WP_002229716.1.63652 WP_002229716.1.63953 WP_002229716.1.63962 WP_002229716.1.64410 WP_002229716.1.64439 WP_002229716.1.64769 WP_002229716.1.65681 WP_002229716.1.66023 WP_002229716.1.67167 WP_002229716.1.67577 WP_002229716.1.6772 WP_002229716.1.68498 WP_002229716.1.68879 WP_002229716.1.69594 WP_002229716.1.70130 WP_002229716.1.71041 WP_002229716.1.71155 WP_002229716.1.72137 WP_002229716.1.72244 WP_002229716.1.73614 WP_002229716.1.73775 WP_002229716.1.73936 WP_002229716.1.74461 WP_002229716.1.75 WP_002229716.1.75147 WP_002229716.1.75822 WP_002229716.1.76040 WP_002229716.1.76043 WP_002229716.1.7727 WP_002229716.1.7744 WP_002229716.1.77601 WP_002229716.1.78092 WP_002229716.1.78133 WP_002229716.1.7854 WP_002229716.1.78664 WP_002229716.1.80940 WP_002229716.1.81356 WP_002229716.1.81937 WP_002229716.1.81942 WP_002229716.1.82134 WP_002229716.1.82942 WP_002229716.1.83826 WP_002229716.1.84443 WP_002229716.1.85000 WP_002229716.1.8529 WP_002229716.1.8554 WP_002229716.1.86928 WP_002229716.1.87226 WP_002229716.1.87407 WP_002229716.1.8844 WP_002229716.1.8874 WP_002229716.1.89003 WP_002229716.1.89734 WP_002229716.1.90103 WP_002229716.1.90964 WP_002229716.1.91227 WP_002229716.1.91720 WP_002229716.1.93332 WP_002229716.1.93412 WP_002229716.1.93815 WP_002229716.1.93820 WP_002229716.1.93999 WP_002229716.1.94471 WP_002229716.1.94970 WP_002229716.1.9524 WP_002229716.1.95325 WP_002229716.1.96240 WP_002229716.1.97261 WP_002229716.1.97394 WP_002229716.1.97396 WP_002229716.1.98500 WP_002229716.1.98700 WP_002229716.1.98836 WP_002229716.1.98925 WP_002229716.1.99094 WP_002229716.1.99616 WP_002229716.1.99744 gi|218768540|ref|YP_002343052.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]