SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374287124|ref|YP_005034209.1| from Bacteriovorax marinus SJ

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374287124|ref|YP_005034209.1|
Domain Number 1 Region: 915-1239
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 6.93e-122
Family Methionine synthase SAM-binding domain 0.0000000276
Further Details:      
 
Domain Number 2 Region: 12-410
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 2.62e-112
Family Homocysteine S-methyltransferase 0.00000542
Further Details:      
 
Domain Number 3 Region: 367-641
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.44e-87
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0034
Further Details:      
 
Domain Number 4 Region: 755-898
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.57e-43
Family Cobalamin (vitamin B12)-binding domain 0.00000606
Further Details:      
 
Domain Number 5 Region: 662-748
Classification Level Classification E-value
Superfamily Methionine synthase domain 3.14e-27
Family Methionine synthase domain 0.0000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374287124|ref|YP_005034209.1|
Sequence length 1239
Comment B12-dependent homocysteine-N5-methyltetrahydrofolate transmethylase [Bacteriovorax marinus SJ]
Sequence
MSELKPYTTMGNELLELLNKRIVFMDGAMGTMIQQYKLEEEDFRGERFKDHASPLKGNND
LLSLTRADIIEEVHFKYLEAGSDIIETNTFSATRIGQADYHLEDLAYEINVESARIAKRA
CEKMMQKDPTRKCFVAGALGPTNKTASMSPDVNNPAYRAVTFDELVENYYQQAKALLEGG
ADILLPETTFDTLNIKCAIFAIDKLFNELDYRVPVMLSVTITDASGRTLSGQTIEAFWNS
VRHANPLSVGINCALGAKEMRPYMDRLSQIADCYTSCYPNAGLPNPLSDTGYDELPIDTA
TFLEDYADSGFLNLVGGCCGTTPSHIKAIREKLEEKKPRVKPTLKEVMNLSGLEPLYIDR
EDQSRPFYMVGERTNVTGSPRFAKLIKNGDFDTALEVARQQVENGANIIDINFDEGLLDS
KACMIKFMNLVASEPEICKVPIMIDSSKWEVIEEGLKCMQGKGIVNSISLKEGEEKFIEQ
AKLIKSYGAATVVMAFDEEGQAADKADKVRICQRAYKILVEKVNFDPRDIIFDPNILTVA
TGIEEHNNYALDFIEAVKEIKETCPGVLTSGGVSNVSFSFRGNNVVREAIHSSFLYHAIK
AGLDMGIVNAGMLGVYEDIEPNLLQLVEDVLLNRHPDATEKLVDFAEKIKGSGKKKEVKD
DKWRHGTLQERMTHALVKGISTHIEEDTEEARQELGIPLNVIEGPLMEGMKVVGELFGSG
KMFLPQVVKSARVMKAAVAYLEPFMEEERKKNANARKQGTFVIATVKGDVHDIGKNIVAV
VLACNGYEVIDLGVMVSCEEIIKKAKEHDACIIGMSGLITPSLDEMIYNVKEFERLGFSC
PIMIGGATTSKAHNAIKIAPHYSGPVAQVGDASLVVEVCSKLLNPTTAPAYTKELKEHQA
KLKERFDLGKQDQSKLVSLEQSREWKFICDWEKQEIATPSFTGIKKYLDVSLEEIVPYID
WSPLFWTWQLKGTYPKILNNEKYGEQAKSLFKDANIILEKVIAEKRFSPKAIVSIHKANS
IGDDVEVYDDNGKKIETFHYLRQQKEKSEHKPHLCLSDYIAPKESGREDYLGNFVVTMGH
EVEEFAKIYEQRNDDYNAIMVKAIGDRLAEAFAEYMHKVIRDEFGYGKEENFSNEDLIKE
KYRGIRPAPGYPSCPDHTEKPIMWDLLNVESEIGVSLTENCAMNPPSSVSGQYFCHPGAK
YFTLGPIARDQVENYSKRKDMEIKRVERWLAPNLGYNPE
Download sequence
Identical sequences E1X3E1
gi|374287124|ref|YP_005034209.1| WP_014243025.1.66676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]