SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374287948|ref|YP_005035033.1| from Bacteriovorax marinus SJ

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374287948|ref|YP_005035033.1|
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily DOPA-like 3.66e-36
Family DOPA dioxygenase-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374287948|ref|YP_005035033.1|
Sequence length 111
Comment hypothetical protein BMS_1187 [Bacteriovorax marinus SJ]
Sequence
MNVKEYHAHLYYSEENLEVAKQVVEKAREFGLFSIGRIHERLVGPHPMWSCQLLFKNDEL
PKAMPWILENREGLIIFMHPDTGNDLEDHTDHAIWIGGKVDLNLEVFKRGN
Download sequence
Identical sequences E1WYW8
WP_014243849.1.66676 gi|374287948|ref|YP_005035033.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]