SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374288598|ref|YP_005035683.1| from Bacteriovorax marinus SJ

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374288598|ref|YP_005035683.1|
Domain Number 1 Region: 213-396
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.88e-57
Family B3/B4 domain of PheRS, PheT 0.0000564
Further Details:      
 
Domain Number 2 Region: 40-194
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.39e-36
Family Myf domain 0.0033
Further Details:      
 
Domain Number 3 Region: 419-490
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 3.66e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.0027
Further Details:      
 
Domain Number 4 Region: 482-692
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.00000000000000318
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0078
Further Details:      
 
Domain Number 5 Region: 712-800
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 0.00000000000301
Family Anticodon-binding domain of PheRS 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374288598|ref|YP_005035683.1|
Sequence length 807
Comment phenylalanyl-tRNA synthetase beta chain [Bacteriovorax marinus SJ]
Sequence
MLISTDWIKDFVSIPEMSPKDLGVKFTLGTAEVEEVLVVGEHLEKIRVAEILEIEKHPEA
DKLNLVTFNFGDKENKRVVCGASNVKVGLKTAYAPLGVSLPNGLVLEPKKIRGVLSEGML
CSEEELGFAQDSAGIIELPSDAPIGQNMIDYYNETKDVILDVDNKSLTHRPDLWGHYGLA
REFGAIFEQELKNPYNDSWANDLRAKFASGPSPITPKLEGESACKAYFGLSVDNVKVEES
PNWMKKRLISVGLRPINNIVDISNYVMLELGMPLHIFDRDQIKDNQIIIKKLGTTAEFTT
LDEEKRNLIESDTVICDADGPLVIGGLMGGLSSGVTDATTKVFIEVANWHASMVRSTSTR
LGLRTDSSQRYEKTLDSKLCERTMLRTLDLILELCPEAKVVGKLEYDGDDLSAIEILELQ
TSFKKINKVLGLEVSNERILSIFNALDFKVTANGDDLSVTIPSYRSTKDIDCEADLIEEI
GRIIGYDNIDPISPKLTIEPVRLTSAQALHRKLRDFLVYNMNSFEVNSYPLIGEKLLSKC
SWPTQSGLNLLNSISKDHSIMRDSIVPNALAIAATNVKNYDDFSFFEIGRTYHLDKANFA
AEKSELIIAMYSKESTPFMDLVNGTSRLLNASNIPFDLSERHPKFKNELISEEWVGVHPF
EFYNIRIMGKMKGVITSIHPLILKQYKIKGHLSIAVVDLSQVESRPLKDKVKYRPLSKFP
SSTFDCTVVTGEHTPVSEVLSSLKKIKIKELQSTKVVDIFTMDTKEKAITLRSVFMDEEK
TLDGEFITQSSQKIVNELQKAGFPLKS
Download sequence
Identical sequences E1X2F1
WP_014244499.1.66676 gi|374288598|ref|YP_005035683.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]