SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374288750|ref|YP_005035835.1| from Bacteriovorax marinus SJ

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374288750|ref|YP_005035835.1|
Domain Number 1 Region: 687-1135
Classification Level Classification E-value
Superfamily ALDH-like 1.31e-108
Family ALDH-like 0.000000125
Further Details:      
 
Domain Number 2 Region: 287-603
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.85e-68
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374288750|ref|YP_005035835.1|
Sequence length 1387
Comment putative proline dehydrogenase [Bacteriovorax marinus SJ]
Sequence
MNSEKKLNFKEFLIPNLLTFALDDWKVIFNCDFEKSLVVDSQLDSAVKEELAPFTKLRFG
DFRQQIILKSAPYLVGFFYDVKEIRIYSPMLSYEFFIIPEMERICEQNEVEAFKSHTEMA
ASLSSREFPSIFQLTTKKYQLTDLLEDTEMDEIEQKSSTIIDELLIHLNKYTPSLFERVS
DYGLGLTAQFALLRIHLLKFLAILPSLDHDLKGREVKRILLEALRRLLSDSLKAKRLGLK
GQNKALPKSLYVWVNIAYYICKICPPGLLAFSVRFKVRFMAKRFIAGETIETAEQALSTL
ASTGRDVTLDQLGELVVSEKEADHYCDEVIKLIKGYSLHVKKGELNAAGINRAHVSIKVS
ALCSDFKPYAFDYTYEHVAPRLKKILLIAKEEDVFINIDAEHYDYRDIVFKVYRKVLLET
EELKDYKATGIVLQAYLRDAYKHLLEIVELAKERGIIMPIRLVKGAYWDAETVEADAHSF
DAPEFLNKEETDLHFRQIIIKIFDFNPHVQLCLASHNFSDHAFAEALRENKYKDLPIIEH
QCLHMTYEALSTAMAKMGWVVRNYVPIGALIVGMAYLVRRIMENSSQVGVLTIMRSHKKN
ISLVTPKEIHKQKIGDGHLERDKTQTHLLGDFTNITPVRTYLDSERKWTEDELEKFKGNL
GKHYANDFLKEGVKQTILSSSNPDIKVGDIIFADASDAKRAVEVCDESYNSGAWANADWA
IRASTLLRAANLMLARRNELSALIVYEAGKAINEALADVDEAVDFLNFYAREEARIQSLN
DRVESRGVSAVISPWNFPLAIPCGMVVSSLVVGNTVILKSAEQTPLISQELVDILHQAGV
PKDVLIHLPGLGEIVGDALVTHERVSTIVFTGSKNVGTLIASKAHSRIYENKLTKASYPV
RVITEMGGKNAVIVTANAELDETVAGILYSSFGHAGQKCSAASRVLVDNAVKDRLIERLK
EACLDIEVGEAYSFRTTVNPVITQEDKQRLIAQVNEAQKEANEFGGKVHVNRSSEELPGY
CVGPSLIELPISRALNPESYAMRELFGPVVHIIGFNHLDQALRIYNGTDYALTGGVFSQS
QDDIDYLTARMESGNIYVNRSITGARVAIEPFGGFKMSGTGPNAGSRSYLSYLHRNPVRE
FTSCKSKKESGSEYTFESSRPSGLSGEGRVQRMDKVVSHVIRHFEHLFSGIRAEEKQTLS
TFHKWLNVNYESFLNREHWNRRIPGQLSYCDYTQGSHKALVAAFRTQPDFEIVFEVILAL
VSGAGITVNCRNNEAYDWWMGFRDILVEYGISKENFDVYFVSEELLKKSLGETDLKHILI
DGTIEDVAEISKWSYENYKDHKHMRNIISKYDMSDINDFKRICRQYVNIRSFAVNTMRHG
APMDVVL
Download sequence
Identical sequences E1X343
gi|374288750|ref|YP_005035835.1| WP_014244651.1.66676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]