SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17158718|ref|NP_478229.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17158718|ref|NP_478229.1|
Domain Number 1 Region: 30-139
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 1.08e-26
Family ParB-like nuclease domain 0.00062
Further Details:      
 
Domain Number 2 Region: 113-144,176-251
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 2.62e-17
Family KorB DNA-binding domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17158718|ref|NP_478229.1|
Sequence length 315
Comment ParB family chromosome partitioning protein [Nostoc sp. PCC 7120]
Sequence
MSQKRELEKLTGLDNLFGDEEEQSLSDSTLPLSQIILPPSQPRRYFDPVKLKSLANSIKE
VGLLEPIAVRKIEEDKYELIAGERRLKACEIAGLEEISVVILECDEKKARKLRLVENLQR
EDLNAYEETIGILELLAEELDLDQEAVVSLLYQMNNETKGNSNHNVMVSEEALAIQTIFL
QIGKISWESFVSNRLPLLKLPQDIQITLEKGQIEYTKAQVIARIKDNKKRQNILKKAIEE
NLSLSAIKELVGDILPIQSENKPQSPQQQNKERASKIYKSLLKSKIWDDEKKVKKVNRLF
DQIEALLEEKKEDAS
Download sequence
Identical sequences A0A1Z4KW33 Q8ZSC9
103690.alr7582 gi|17158718|ref|NP_478229.1|NC_003240 WP_010993910.1.33676 gi|17158718|ref|NP_478229.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]