SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17158754|ref|NP_478265.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17158754|ref|NP_478265.1|
Domain Number 1 Region: 799-1025
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.05e-48
Family Multidrug efflux transporter AcrB transmembrane domain 0.00031
Further Details:      
 
Domain Number 2 Region: 298-502
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 6.15e-39
Family Multidrug efflux transporter AcrB transmembrane domain 0.00012
Further Details:      
 
Domain Number 3 Region: 42-133
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 9.42e-25
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0016
Further Details:      
 
Domain Number 4 Region: 155-189,275-328
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 9.03e-16
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.011
Further Details:      
 
Domain Number 5 Region: 717-803
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000126
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0046
Further Details:      
 
Domain Number 6 Region: 190-272
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000000017
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17158754|ref|NP_478265.1|
Sequence length 1058
Comment cation efflux system protein [Nostoc sp. PCC 7120]
Sequence
MIDNILKWSIVQRWLVVIGAMIVMMLGVYNLTQMPLDVFPNFAPPQVEIQTEAPGLAPEE
VESLVTLPIESAVNGTPGVETVRSSSGIGISVVRIIFNWGTDIYQARQLVTERLQQASQK
LPANIESPQISPISNPIGTILTYAFTIDSPGGKAKTDMMEVRRFIDLVVTNRLLAVPGVS
QVITYGGDVRQYQVLVDPAKLKAFDVSLEDVTTAAAKANNNAAGGFLIDPDQELLIRGIG
RITAIEDLQKSVITARDGTPVLLRDIADVQIGAALKRGDGSFNTQPAVVVLIDKQPQADT
PTVSRAVETAIAELKSSLPANVKYTVTFRQESFIEDAIENVTSSLRDGTIIVSIILLMFL
MNWRTAIITLSAIPLSVLIGMMILNLFGQGINTMTLGGLVVAIGSVVDDSIVDMENCYRG
LQENQKAENPVHPFQIVYDTSVEVRTSVILSTVIIVVVFAPIFTLSGIEGRIFAPMGWAY
LVSILSSTLVAMTLSPALCAILLANQRLPDDETWVTRWSQRLYRPLLNFSIKRPSVVILT
AIAAFVASMVIFSSLGRVFLPEFQERTLVNSLLLYPGTSLEVTNQAGNAIESALKDDPRI
ASVQMRSGRAPGDADAAPVNLTHLDIEISDVGMKDREATVEKVREEFARIPGSVAAIGGF
ISHRMDEILSGVRSAIAVKIFGPELEELRALGKEVEAVMKDIPGLVDLQLEPQIPIKQVQ
IQFDRDAAARYGLSVGDLSEITETALNGRVVSQVLEKQQLFDLLVWLKPEARNNLDTIRN
LLVDTPNEQKIPLAAVAKIDYGTGPNTINRENVSRLIVVSANVSGRDLGSVVDEIRAKVQ
QQVQVPSGYFIQYGGQFESEQRASQNLLVFGSLSMIVIAVLMYFAVKSIPATLIIMSNLP
LALIGGVLSVALGGGILSVASMVGFITLFGVATRNGLLLVENYNSKFAIGMPLREVISQG
SIERLVAILMTALTSALGMVPLVIGTGAGKEILQPLAIVVLGGLFTSTALTLLVLPALYS
KFGTYLIPKQTSPAIQTGIASEITTSQDLSILNNSKRR
Download sequence
Identical sequences A0A1Z4KVP7 Q8ZS94
WP_010993946.1.33676 gi|17158754|ref|NP_478265.1|NC_003240 103690.all7618 gi|17158754|ref|NP_478265.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]