SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17158806|ref|NP_478317.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17158806|ref|NP_478317.1|
Domain Number 1 Region: 66-150
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000206
Family Group I mobile intron endonuclease 0.036
Further Details:      
 
Weak hits

Sequence:  gi|17158806|ref|NP_478317.1|
Domain Number - Region: 18-56
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0778
Family Group I mobile intron endonuclease 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17158806|ref|NP_478317.1|
Sequence length 172
Comment hypothetical protein alr7670 [Nostoc sp. PCC 7120]
Sequence
MRCSHHQIAEMHNSNQKHQYPFGKTYTNGKAFRLRINSKQICDDLIGRFNITPNKSLTLE
PPVLDNEQLIKAFIIGLIDGDGGVNLFKVKGKVNSIEIDLTGTIEVLNWVKNWFDIWVPN
NHYKCAKPKQSMNSKAYRYHVAGKRGIELWKILSQVNVPKLKRKWHKPLPYF
Download sequence
Identical sequences Q8ZS42
gi|17158806|ref|NP_478317.1| 103690.alr7670 WP_010993998.1.33676 gi|17158806|ref|NP_478317.1|NC_003240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]