SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17227381|ref|NP_478432.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17227381|ref|NP_478432.1|
Domain Number 1 Region: 27-138
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 1.1e-24
Family ParB-like nuclease domain 0.00022
Further Details:      
 
Domain Number 2 Region: 110-141,175-254
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 1.03e-16
Family KorB DNA-binding domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17227381|ref|NP_478432.1|
Sequence length 314
Comment ParB family chromosome partitioning protein [Nostoc sp. PCC 7120]
Sequence
MTKKRLEVPKMRGVEDLLTMDVDASPITTISIHKIRVAKQPRRWFDPEKMSHLVQSVREH
GILEPLLVRPLGNGEYELIAGERRLRAALEASLAEVPIVSKELTDKQALQVALLENLQRE
DLNPVEEVEAILELLAIDLDVSIEDVKSILNEAANAKKRNLELTGNVSRQLEQIEFILAG
IGKFNAESFRTSRLPLLSLPADVMEVLRQGQLEFTKARTIARVKDQQQRADLLSSAITQN
LSLTQIKELIKQLESAQTTPAAATPEKVLSKRYTEIGKRLQQTKLWKDDKKRKKLERLLN
DLEKLLDESEMSNN
Download sequence
Identical sequences A0A1Z4KW74 Q8YKA8
gi|17227381|ref|NP_478432.1|NC_003267 WP_010994065.1.33676 103690.alr8007 gi|17227381|ref|NP_478432.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]