SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17227385|ref|NP_478436.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17227385|ref|NP_478436.1|
Domain Number 1 Region: 43-188
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2.41e-48
Family DNA/RNA non-specific endonuclease 0.0000000702
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17227385|ref|NP_478436.1|
Sequence length 189
Comment hypothetical protein alr8011, partial [Nostoc sp. PCC 7120]
Sequence
MRQFMGICRNLGVAALVALIVGCSPVQSQVPPLTELSPSISVHLLLGNPSGATPTKLTPD
NYLMVKNQYALSYNNSKGTANWVAWQLNSSWLGDADRQNNFRPDNTLPAGWVRVTPSMYS
GSGYDRGHIAPSGDRTRTAEDNAATFLMTNMMPQTPDNNRNIWGNLEDYCRELVSQGKEL
YIVAGPSGS
Download sequence
Identical sequences Q8YKA5
gi|17227385|ref|NP_478436.1|NC_003267 gi|17227385|ref|NP_478436.1| 103690.alr8011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]