SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17227393|ref|NP_478444.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|17227393|ref|NP_478444.1|
Domain Number - Region: 235-275
Classification Level Classification E-value
Superfamily Ava3019-like 0.0562
Family Ava3019-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17227393|ref|NP_478444.1|
Sequence length 410
Comment hypothetical protein alr8019 [Nostoc sp. PCC 7120]
Sequence
MSDNQVVESIQDKYDSLKPYLNEKTRRVWAAIEARSLGWGGISQVALATGLSRTTIHAGI
RLLLEASEEETSNGDSNRIRSSGAGRKLLEEKDAMLLSDLESLIEPVTLGDPESPLKWTS
KSVVKLAAALNIGGHRTSPKSVYNLLESLGYSLQSNRKTRDGSSHPDRDDQFLHISKQVL
HFQSQNEPVISVDTKKKELIGDFKNSGTEWCEKARPIEVKMHDFVDPKLGKAIPYGIYDL
TSNQGWVNVGIDHDTAEFAVESIRHWWYSMGKEVYPKSQHIMITADCGGSNSYRSRLWKL
KLQELATETGKTIHVCHFPPGTSKWNKIEHRLFCHITQNWRGRPLTSLQVVINLIRNTTT
TQGLEVEARLDPNLYKTGIKVTDQELETIAIERNSFHGEWNYIIKPKVGT
Download sequence
Identical sequences Q8YK98
103690.alr8019 WP_010994077.1.33676 gi|17227393|ref|NP_478444.1| gi|17227393|ref|NP_478444.1|NC_003267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]