SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17227394|ref|NP_478445.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17227394|ref|NP_478445.1|
Domain Number 1 Region: 325-760
Classification Level Classification E-value
Superfamily Lipoxigenase 8.63e-66
Family Animal lipoxigenases 0.033
Further Details:      
 
Domain Number 2 Region: 21-337
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 7.98e-61
Family Allene oxide synthase 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17227394|ref|NP_478445.1|
Sequence length 773
Comment hypothetical protein all8020 [Nostoc sp. PCC 7120]
Sequence
MDLNTYLKLLNLLDSESQKIMLELQAMFSAAGLALRGRGTHTDGIIVKGNLTVLHSSDVP
SHSLFTPGKKYDVIFRHANIVGGAKDDALINGRGSAIRIGNIGDDLSKPRLLDLVLNTGE
VFGLPTARLYHQFFGSDFHQKSDMLASGSLRRYAVEAALRNPDSFTELYYHTQLCYEWVD
SKKKSRYARFRLLNPNQSTEGGLLDDSVEIGPRLVLPRKRGDTREKNYLRNEFRQRLTDG
NIVEYVLQAQFRSIEDVAVDCSNIWDPNTYPWLDIAAIVLNQDESENDYYQEIAYNPGNT
HYDLKLPNSYSVDDFASLGVSGALVHYFGSIVRAERTQYLYGSKDDLPGKPVYFPLPVTE
IPSKRFLFLLEKYNFLTDNSYPSDGEHDKIEALVSAMPTTALDLAVGTTDPTDIPDSYFL
ERRLNGYNPGAIRESSGQEGWTHELTHNLAKYDIKPGLHFPDFVQCRLFVDKQNGVKLHS
IKIDDHEITPCQEQWQYAKRTYLQAEFLSQELKLHLARCHFNIEQYVMAIKRRLAPTHPV
RAFINPHLEGLIFINSSAVPKIIGSTGFIPIASMLTQGSIVDVMKNELSKLSYMWNPIAD
LPRDIPGDLFTPAATAYWELLNNYVEQGLLQPFEDELRTEVNAIQVDELFAELKERSLYS
GDQPPKYDSSELKSLLMYIIYHSSFLHSWANFKQYDDAGNPNHVSMGDYSQYDQQTQDKI
RFSQRSLTWVLSSIRYNSVAVYGSDLLKQLIREKSSILEPGLPLEDLMMSINI
Download sequence
Identical sequences A0A1Z4KW84 Q8YK97
103690.all8020 WP_010994078.1.33676 gi|17227394|ref|NP_478445.1|NC_003267 gi|17227394|ref|NP_478445.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]