SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17227478|ref|NP_478660.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17227478|ref|NP_478660.1|
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily CheY-like 4.27e-25
Family CheY-related 0.00085
Further Details:      
 
Domain Number 2 Region: 149-216
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000000156
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17227478|ref|NP_478660.1|
Sequence length 223
Comment two-component response regulator [Nostoc sp. PCC 7120]
Sequence
MLRIVIVEPETFTLLGFKAAIEQSPDIEVTGSATSGKIGFQLIEQVNPDVVLVDLLLPDM
SGLELTRSIKRNTNSKVVIFTNETHSDFINSAFRHGADSYMLKSADVELIELAIKRAYFD
ECLLDPKLAKKLLESLYQNRYIDPTFVDKNLIDPPTERQIQVLRLLAQGLVFQDIAKEMF
LSVSTVKQYASDLYSKWHVKNRYEAIKRGAMLGYIDYNLIVNE
Download sequence
Identical sequences Q8YJV0
103690.alr9013 WP_010994160.1.33676 gi|17227478|ref|NP_478660.1| gi|17227478|ref|NP_478660.1|NC_003270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]