SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17227865|ref|NP_484413.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17227865|ref|NP_484413.1|
Domain Number 1 Region: 230-496
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.47e-41
Family Calpain large subunit, catalytic domain (domain II) 0.0021
Further Details:      
 
Domain Number 2 Region: 7-117
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.29e-17
Family Collagen-binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17227865|ref|NP_484413.1|
Sequence length 501
Comment hypothetical protein alr0369 [Nostoc sp. PCC 7120]
Sequence
MALDKVGNTLSNSQKITFNTKTQTISDWVGSSDINDFYSFSLSSHSSVSIAIDGLSANAD
LQLLKDKNSNNSIDKGDVIASSSKGGTLSESISKTLNAGNYFIRVYSKRGNTEYELKFFQ
TSSTSPEEVYKESSVSSNAGNSTLAATSADWFSQNLNDQKIVSLARNLASDGKLSRQDML
DIFRNVQDNSVVDSNEVKDLKTIVAAGNNFNIEDHVKWLSAQVANGASSGMSASNFESKL
VGRWFLGTVAPTPEFNGKKLTYTEVKGNLFGSTNKAEIGDIHQGIINDCTFLAALGATFS
RQSDDSGNASSSVIKNMIKDNGDNTYTVRFYSGKYYAPGEAQYVTVDRRIATNIAAQRND
GVLWVALVEKAYAQWREWTDGRPGYNIIGNGGALAPPLSFITGRKTNNYSKSRISFSLLE
DALKAGKAITTSRSGKDTSFILGSHAYSVSNAYISASGEQRVVVRNPWGVDGKAKSGAND
GFINLSYQEFINSFNLGVSVS
Download sequence
Identical sequences A0A1Z4KQN6 Q8YZT8
WP_010994545.1.33676 gi|17227865|ref|NP_484413.1| 103690.alr0369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]