SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17228201|ref|NP_484749.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17228201|ref|NP_484749.1|
Domain Number 1 Region: 7-316
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 2.09e-85
Family Acetamidase/Formamidase-like 0.000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17228201|ref|NP_484749.1|
Sequence length 328
Comment hypothetical protein all0706 [Nostoc sp. PCC 7120]
Sequence
MTHHILKATKSTVHLGGFSHLLEPALKVDSSDTIDVETYTGYYIYDKAPPEFLTPEFLDI
CQNLPPERKIAAGPHLLTGPIYVKDAEPGDVLEVKLEAIAPSLPVGFNAIRSGWGALPNQ
FTQPALRFIPLNLANNTAEFPPNSGIKIPLTPFFGILGVATPENARSSVPPGYYGGNIDN
RELQAGSRIFLPIFVPGGLFSLGDGHSAQGDGEVNVTAIETSMNGRIQLTLRKDLHFTAP
IAETPTDIITMGFAPTLDAALEQALKNMIDFLERFVNLSPEDAYVLCSLAVNFRITQVVN
SPNKGVHGLLPKKLFEEAVSIKPFIRRS
Download sequence
Identical sequences A0A1Z4KRM4 Q8YYY6
103690.all0706 gi|17228201|ref|NP_484749.1| WP_010994881.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]