SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17228510|ref|NP_485058.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17228510|ref|NP_485058.1|
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily Transposase IS200-like 3.79e-34
Family Transposase IS200-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17228510|ref|NP_485058.1|
Sequence length 191
Comment hypothetical protein alr1015 [Nostoc sp. PCC 7120]
Sequence
MPEYRRAYLPGGTFFLTLVTYERYPIFSNIENISHLRSALAKVRSEMPFEIEGAVVLPDH
IHFLWTLPTDDKNYSQRIGRLKVLFTRSIDSKTILPKNLSNSRRKHRESNVWQRRFWEHN
IRDEADFEKHLNYIHYNPVKHGLVSCPHLWDYSSFHKFVRRGIYCSNWYCSCSGERIQIP
DFDKNLEKIGE
Download sequence
Identical sequences A0A1Z4KSK4 Q8YY37
gi|17228510|ref|NP_485058.1| 103690.alr1015 WP_010995189.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]