SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17228579|ref|NP_485127.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17228579|ref|NP_485127.1|
Domain Number 1 Region: 365-607
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.31e-40
Family Calpain large subunit, catalytic domain (domain II) 0.0025
Further Details:      
 
Domain Number 2 Region: 16-123
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000144
Family Collagen-binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17228579|ref|NP_485127.1|
Sequence length 611
Comment hypothetical protein all1084 [Nostoc sp. PCC 7120]
Sequence
MIFDHAGNTLGSARRVNLTTTTQTFTDFIGSRDVNDFYSFSLNSRSSLNLTLGGLTTNAD
IQLIQDKNSNRIIDGISEIIGSSNLLGIASDSIRTTLDTGNYFIRIFPGSGSTVNGTNYN
LSLSINTAPNSLAFTIDNPTITNTGSLNISRGQVFDANGARDISVIDFQLFQNGLLVNSI
SNDVTRITINTNDSRWGSFTHNLSLSGLNLAGGNYTLRATALDTFRSTSQVVERVFTIAA
DWLSQNLKDRQMLTLVKNLAQDGNLSRNDIVTIFRDAKDNGVVDVNELSDLRLIITNAPR
FTIQDHVRILSNKVANGDMANINSGIGNLFAGSSADQLEKLLGKWFFGSDRPQLTSTQFT
YREARGALFQNGISYQDVDQGAIGNCYFLAGLANTALRTPNVIQSMFIDNGDNTFTVRFY
NNKVADFVTVDKFLATLNNLNSNYVSGGNIPYAKIGGRHDNPNTELWVALAEKAYAQINE
SGWTRGPASGQRRNSYQAIVSGYAGRAITDITGSSTQYDNLDSLDMNAIVTAFNQGQMIC
FASRSSTQVATNVVSSHAYVLVSYSSSTQRFRLYNPWGVNGGYENGIFKNGFLDLSFNDL
LRNFLGWDKTI
Download sequence
Identical sequences A0A1Z4KSW1 Q8YXX3
103690.all1084 WP_010995258.1.33676 gi|17228579|ref|NP_485127.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]