SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17228881|ref|NP_485429.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17228881|ref|NP_485429.1|
Domain Number 1 Region: 80-99,133-192,224-440
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 3.4e-44
Family Nitrous oxide reductase, N-terminal domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|17228881|ref|NP_485429.1|
Domain Number - Region: 545-603,660-882
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.00105
Family Arylsulfatase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17228881|ref|NP_485429.1|
Sequence length 1001
Comment hypothetical protein alr1386 [Nostoc sp. PCC 7120]
Sequence
MFNFQRKRYFLLSLLVAVAVVVSSVQIVTAQLATSRVGDLPEGGALLPTGQVITPAAAPG
STFDRLATGLRSDNNADAAEAVTTALSPDGKTLLVLTSGYNLNFRNQNTGANLTYPVLDP
VTGQPTATTTRKAEWVFVFDVSSGKLVKRQQINIPNTYNGLAWAKDGSRFYVSGGIDDRV
YVYAANGNQYIANAPFILLGHNSNQTDPFPSYDGGLLKNTPANRVTTGAVVAGLAVSPDG
STLVAANFENDSISLVNTANRQVTEEIKFFKPGDQVPTGEFPFDVALKSTTNGAAAKVFV
SSQRDDEVVAVDVASRVITRIPVGSQPNKILLSADQNKLYVANGNSDTISVIDTNSNRVI
GTISLSRPNDKYVGSSPNSLALSPDERTLYVTLAGENAVAVVDLRSGRVSGRIPTGWYPN
SVSVSQDGRKLFVVNAKSNSGPNPSQSRTTPAGLARNTTFRNEYNWALEKAGIAVIPVPS
AGSLAALSRQVDKNNGFDNRRPDRTMRFLQGKIKNVIYVLKENRTYDQVLGDLPIGNGDP
ALTLLPEPISPNHHKLALDFVTFDNFYDSGESSGVGWNWSTYGRTTDYTEKTQSVLYGNA
GFNGLTYDYEGLNRNINIALPQTNSTSQFNTRVTGVLDPSGRSSILPGTKDVNAPIGDGE
ISPNSVGGYLWDAALRAGKTVRNYGFYVDGFYGTNQADPTKPDPSDPLYVPISPTPAVDN
IQQAVAAKTVLLDKTDNYFRGYDMKNADIYLYNEFARDIDKYLANNTLPNLTMVRLPHDH
FGDFNNAVAGLNTVPLQMADNDYAVGLLVEKISKSPAWKETAIVILEDDCQNGPDHVDSH
RSIAYIISPYTKRKVLISTNYNTVSIIRTMEDLLGIGYLGMNDANAKPMSDAFTREPDFT
PYTAVVPGNLCTAPVDPNLVPACQDPNVPKTAAIPSLHDKQWWAQATKDFYFEVEDKVDA
DAFNRVLWSGIKGDNVPYPTERSHADLRQNRAQLVANQAKS
Download sequence
Identical sequences A0A1Z4KTN5 Q8YX32
103690.alr1386 WP_010995558.1.33676 gi|17228881|ref|NP_485429.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]