SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17229148|ref|NP_485696.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17229148|ref|NP_485696.1|
Domain Number 1 Region: 300-488
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.44e-39
Family Multidrug efflux transporter AcrB transmembrane domain 0.00016
Further Details:      
 
Domain Number 2 Region: 799-1021
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 3.14e-39
Family Multidrug efflux transporter AcrB transmembrane domain 0.0013
Further Details:      
 
Domain Number 3 Region: 38-129
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.09e-20
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.002
Further Details:      
 
Domain Number 4 Region: 184-265
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000732
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0024
Further Details:      
 
Domain Number 5 Region: 709-799
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000011
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.015
Further Details:      
 
Domain Number 6 Region: 146-181,269-325
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000196
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.017
Further Details:      
 
Domain Number 7 Region: 556-652
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.000000455
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17229148|ref|NP_485696.1|
Sequence length 1034
Comment hypothetical protein alr1656 [Nostoc sp. PCC 7120]
Sequence
MNNLFYQNVRLLILTVLAIAVWGLSSFFSLPRIEDPEITPRFAVITTSFPGAAPERVETL
ITDKLEQSLFEVEEINNIESTSRLGFSSITVELNETINDVDPVWSRVRAKINDTIPLLPS
GAATPKFEQSKPKANALIVALTWDLESAPNYAILSRWAQELDDQLRLIGGTEKVEQFGTP
QEEIAIEVNPKQLTNLGLTIQSVSQQILQSDAKVAAGQLRSNQSNLLLEINGELDSLDRL
NRLSIQLGNSSNVVRLGDIAQIKKGILDPPRELALVKGRRAIAISAFVESEQRLDAWAAI
ANTTLNKFQQQLPNGVGLQILFDQSHYVEQRLNEVLMNLITGAVLVVGITLFMMGWKSSL
IVGSALPLSVFMVFGSMKLLGVPLHQISVTGLIIALGLLIDNAIIVVDEVQIYLREGLTP
KKAVATTVREIFSPLLASTFTSVLAFVPIATAPGGTGEFTGTIGVTVILALVSSLFLALT
VIPALAGRLHYWKPTPASGSWWQVGFSHHHLGQLYSWSLDRTFSRPLLSIALSLILPLWG
FISLANLEQQFFPPTDRGQFYVNFELPIQASLQQTQSQVTQARELMLRHPEIADVQWFIG
KSAPPFYYNVIQNRENSPNYAQGLVQLQKNVKSGSLIRTLQQELDQAFPAAQIIVRQLEQ
GPPFDAPIELRVYGSDLDRLRELGDQLRAELAKTPNVIHTRANLTETLPKLALNLDEEQL
RLAGLDKTAVARQLDTNLEGIVGGSIFEGTEELPVRVRSLESQRGNLGDIASSTLLSPEN
SNQSGNRVVPLSAVGNLEIVPDVVTISRRNGKRVNTVQGFIPAGMLAAQVQTDFQDRLTA
SNFTLPSGYSWDFGGEEGERGDALSNLISTVGVLMIMMIASLVLTFSSFRLASIILVVAI
LSMGLGLGSLALFNYPFGFTAILGMIGLMGVAVNDSIVVLSSLNHDPKARQGDRHAARKV
VIRSTRHVIATTLTTIIGFTPLLLDASGFWPPLAITIVGGLGGATLIALYFVPSVYLLLQ
RSLTKESRKNNLNN
Download sequence
Identical sequences A0A1Z4KE66 Q8YWF7
103690.alr1656 WP_010995825.1.33676 gi|17229148|ref|NP_485696.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]