SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17229340|ref|NP_485888.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17229340|ref|NP_485888.1|
Domain Number 1 Region: 76-256
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.77e-40
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 5-75
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000405
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17229340|ref|NP_485888.1|
Sequence length 276
Comment hypothetical protein all1848 [Nostoc sp. PCC 7120]
Sequence
MILPKPSLEDIEIKLLLEGVYQYYGHDFRNYAVSSLKRRIYSFMRLEGVDNISALQEQLL
HDRTCLERFLLSLTVNVTSMFRDPSFYLAFRNQVVPILRTYPFIRIWHAGCSSGEEVYSM
AILLQEENLYHRCRIYATDTNEKVLQNAKSGIFPLKMMQEYTQLYLKAGGKQSFSEYYTA
AYDHAIFRASLRENIIFAQHNLATDSSFNEFNVIFCRNVLIYFNQILQKRVHTLFHNSLC
SFGILGLGKQESIRFTPYEQYYEEIAKGEKLYRRLN
Download sequence
Identical sequences A0A1Z4KF22 Q8YVX1
103690.all1848 gi|17229340|ref|NP_485888.1| WP_010996016.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]