SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17229614|ref|NP_486162.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17229614|ref|NP_486162.1|
Domain Number 1 Region: 3-198
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 1.26e-38
Family Isochorismatase-like hydrolases 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17229614|ref|NP_486162.1|
Sequence length 202
Comment hypothetical protein alr2122 [Nostoc sp. PCC 7120]
Sequence
MQPQSTAVILIGYQNDYFAADGILHNVIEESSRATKVLENTVELVGCLLQIPVLMIATPI
FFTPNYQELVEPVGILKTIKEVGAFQADTKGSQMIDELLPFCSKILEVPGKRGFNAFMNT
NLDMILHEKEITHVVIAGAVTSVCIDSTGRSAHEKGYQVVILSDCTSARTVFEQEFYHTH
VFPLYADTINHTELLQRLTSTV
Download sequence
Identical sequences A0A1Z4KFL1 Q8YV59
103690.alr2122 gi|17229614|ref|NP_486162.1| WP_010996280.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]