SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17229637|ref|NP_486185.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|17229637|ref|NP_486185.1|
Domain Number - Region: 235-275
Classification Level Classification E-value
Superfamily Ava3019-like 0.0379
Family Ava3019-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17229637|ref|NP_486185.1|
Sequence length 316
Comment transposase [Nostoc sp. PCC 7120]
Sequence
MSDNQVVESIQDKYDSLKPYLNEKTRRVWAAIEARSLGWGGISQVALATGLSRTTIHAGI
RLLLEASEEETSNGDSNRIRSSGAGRKLLEEKDAMLLSDLESLIEPVTLGDPESPLKWTS
KSVVKLAAALNIGGHRTSPKSVYNLLESLGYSLQSNRKTRDGSSHPDRDDQFLHISKQVL
HFQSQNEPVISVDTKKKELIGDFKNSGTEWCEKARPIEVKMHDFVDPKLGKAIPYGIYDL
TSNQGWVNVGIDHDTAEFAVESIRHWWYSMGKEVYPKSQHIMITADCGGSNSYRSRLWKL
MFRIHLPCNHNDFCKP
Download sequence
Identical sequences A0A1Z4KFQ4 Q8YV36
gi|17229637|ref|NP_486185.1| 359441 103690.all2145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]