SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17229770|ref|NP_486318.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17229770|ref|NP_486318.1|
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 5.49e-55
Family H-NOX domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17229770|ref|NP_486318.1|
Sequence length 189
Comment hypothetical protein alr2278 [Nostoc sp. PCC 7120]
Sequence
MYGLVNKAIQDMISKHHGEDTWEAIKQKAGLEDIDFFVGMEAYSDDVTYHLVGAASEVLG
KPAEELLIAFGEYWVTYTSEEGYGELLASAGDSLPEFMENLDNLHARVGLSFPQLRPPAF
ECQHTSSKSMELHYQSTRCGLAPMVLGLLHGLGKRFQTKVEVTQTAFRETGEDHDIFSIK
YEDSNLYDD
Download sequence
Identical sequences A0A1Z4KG06 Q8YUQ7
103690.alr2278 cath|current|2o09A00/1-182 cath|current|2o09B00/1-182 cath|current|2o0cA00/1-182 cath|current|2o0cB00/1-182 cath|current|2o0gA00/1-182 cath|current|2o0gB00/1-182 cath|current|3l6jA00/1-182 cath|current|3l6jB00/1-182 cath|current|3tf8A00/1-183 cath|current|3tf8B00/1-184 cath|current|3tf9A00/1-183 cath|current|3tf9B00/1-184 cath|current|3tfaA00/1-183 cath|current|3tfaB00/1-183 2o09_A 2o09_B 2o0c_A 2o0c_B 2o0g_A 2o0g_B 3l6j_A 3l6j_B 3tf8_A 3tf8_B 3tf9_A 3tf9_B 3tfa_A 3tfa_B WP_010996435.1.33676 gi|17229770|ref|NP_486318.1| 354449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]