SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17229936|ref|NP_486484.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17229936|ref|NP_486484.1|
Domain Number 1 Region: 226-626
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-94
Family RecA protein-like (ATPase-domain) 0.0000000418
Further Details:      
 
Domain Number 2 Region: 18-176
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0000000000000445
Family GSPII protein E N-terminal domain-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17229936|ref|NP_486484.1|
Sequence length 670
Comment general secretion pathway protein E [Nostoc sp. PCC 7120]
Sequence
MTYSSPQRRSTALTTRTEFSPFGNKLVQSGYINTEQMRQALIESRKSGRPLTEVLESITG
RQLSPEYLRQYKKQQLFELKILYGVEYLDPEVNNIGSSMVGNLIETLIPVDICRRHRLVP
LSKNDEHTPPYVLVAMVAPDNLEASDDLNRILRPQGLTLQRMVITQEDYQQLINQYLDEL
AVRQKHLEQEKFTDINQDLENLGNLDLEDAPEEMEADLGSAMKGAEDAPVINLVNRILAK
ALHEKVSDIHIEPQEENLRIRFRKDGVLREAFDPLPKKIIPAVTARFKIISNLDIAERRL
PQDGRIRRMFEGRKVDFRVNTLPSRYGEKVVLRILDNSSTQLGLNKLITDPETLQIVQDM
VSKPFGLILVTGPTGSGKTTSLYSALSEKNSPGINISTVEDPIEYSLPGITQVQVIREKG
LDFATALRAFLRQDPDVLLVGETRDKETAKTAIEAALTGHLVLTTLHTNDAPGAIARLGE
MGIEPFMVSSSLIGVLAQRLVRRVCSECRIAYTPTTEELARYGMSASQEVSVTFYKANIV
PAEAIAEAKAKNELCPACNGVGYKGRCGVYEVMRVTENLQTLINEEAPTERIKEVAVEEG
MKTLLAYSLDLVRQGATTLEEVERVTFTDTGLEAELKAKRKTGLTCRTCSAILQPEWLDC
PYCLTPRFED
Download sequence
Identical sequences A0A1Z4KGH2 Q8YUA8
WP_010996600.1.33676 103690.all2444 gi|17229936|ref|NP_486484.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]