SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17229949|ref|NP_486497.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|17229949|ref|NP_486497.1|
Domain Number - Region: 61-134
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0647
Family Recombination endonuclease VII, N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17229949|ref|NP_486497.1|
Sequence length 165
Comment hypothetical protein all2457 [Nostoc sp. PCC 7120]
Sequence
MGKVLVLNASYEPLNITSWRRAVVLLIKGKAERVEHNGRFLYSDFPLPTVIRLRHYVRVP
YKEIPLTRRNILHRDGHTCQYCGYTGDELTLDHVNPRSRGGGDSWENIVTACVRCNVKKG
SRTPQEARMPLRHLPRQPYSSLYFEVSKHLKSGLHQEWQKYVIGL
Download sequence
Identical sequences A0A1Z4KGG9 Q8YU97
WP_010996613.1.33676 NsR203 103690.all2457 gi|17229949|ref|NP_486497.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]