SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17230146|ref|NP_486694.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17230146|ref|NP_486694.1|
Domain Number 1 Region: 1275-1415
Classification Level Classification E-value
Superfamily beta-Roll 6.67e-28
Family Serralysin-like metalloprotease, C-terminal domain 0.00029
Further Details:      
 
Domain Number 2 Region: 1170-1281
Classification Level Classification E-value
Superfamily beta-Roll 1.07e-17
Family Serralysin-like metalloprotease, C-terminal domain 0.00084
Further Details:      
 
Domain Number 3 Region: 153-286
Classification Level Classification E-value
Superfamily CalX-like 0.0000034
Family CalX-beta domain 0.013
Further Details:      
 
Domain Number 4 Region: 962-1035
Classification Level Classification E-value
Superfamily CalX-like 0.0000157
Family CalX-beta domain 0.014
Further Details:      
 
Weak hits

Sequence:  gi|17230146|ref|NP_486694.1|
Domain Number - Region: 364-409
Classification Level Classification E-value
Superfamily CalX-like 0.00209
Family CalX-beta domain 0.018
Further Details:      
 
Domain Number - Region: 1042-1172
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.011
Family Collagen-binding domain 0.015
Further Details:      
 
Domain Number - Region: 785-904
Classification Level Classification E-value
Superfamily CalX-like 0.017
Family CalX-beta domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17230146|ref|NP_486694.1|
Sequence length 1417
Comment hypothetical protein all2654 [Nostoc sp. PCC 7120]
Sequence
MTSLVNFNAIAGAFDSQDNLVASAIVKSLEDGTSLLTFVFSVDGEVPAEGLIVTVNSDIA
FRDNFSNLGLEPFSPGGEFVGAVFNADGEATGFKFKLTQANALINLAVKDNGAGTQTATF
TLEAGDDYSIGDSSSEVTFYASLEEVPTPSVTPEISLSVENATISEAEGNTTTLRFTLSE
PPPAGGVLVYVKSNTQTGGEGDPAGRDISEFDVYNAQVEGGVFPAPNFAANGFYFKITEQ
TASITLSAFADDAVEGIEELTFNLQSAPGYTINETASGATITVVDDATSQIQVSLTTSPQ
LLIESESTISLHTFNLSATPPAAGVTVSVNAPNLNEFNLDAIQVEGGEIVAVRSDGFDLK
ITAKSATIQLPIQADGVAESDEQVVFSLSPGAGYQVNQAANSGNFTIVDVPELAPPLSEV
SEPNDTIDTAFDTRLSADAPFFTINSTLDFDFDNSYVTDNGLVYVDASEDVDFYKVELKA
GDTIKIDTDSNQFADGRKVDTWLRLFDVSGTELASNDDGAAPNEVFDSGFQSYIEFTAPS
DGVYYVGVTLYNNSEYDPNKPASGNGYSSTDPDEYGTGEYTLNISLNNPTGFVAGATEIP
PGNGAGPTIFLQTIAGTYNNDFENRDFQILAPALVETSGEDAGSALNIVLVAGGEVPEEG
IDVFITSDIVLTDYFGGLEEDYSVPYGGNLNGKPFSRGGEFLDAVYNEAGEAIGFRFRLT
ESFATITLNPTNREEAETDGAETATFTIVESLGYQVNPAASSSTVTFYDTLEQVPAPSVT
PEVSLAFSTTELIESEETSFTITISLSEPPPAEGVQVYISGNAQDALNEFSIFQAQFTGG
VPIADGAVSGFYFKLLAQTATITLPVFNSTDIVEGIEEFNFEVKPGVGYTVNPEQSSAVI
TIKDTPESEIQVSLSTEPQVLIETEGTVAKLNFSLSATPPVAGVIVTVSVTDIAENFVTD
SLVVEGGELLGFSAADNTFTLKITEKTASLSVAIANDNIAEGVETATVTLLAGDGYQINP
LANSGTLTLVDSPELAPSSLEESNDTLATAIATGLTTTNTTVTFDSEIAEYTVGEGEERI
QVDGTEDVDLYKVNLKVGEKLSINVDAAEIDSKLLYAQLRVFDAEGNELAKTDFDDFQAA
PDEVFSAFNDPYLEFTAETTGTYYVGISQIGNDYYDPNVVGSGSGWLFADFGIENGEYTV
SFNLTPEQPTNPVGTSGDDTLIGTDEEESLFGNGGNDILYARGGDDKLFGGAGDDLLDGG
EGNDALFGGAGTDTLLGGAGNDYLTGGTGDNLLDGGDGNDLLYGNGGQDTLLGGAGDDII
YSGSGDDLINGGLGNDIIFLNGGQDTIVVAQGAGIDTINNFQVSLGQKVGLSGGITFEQL
TFSQSGLDTLIQVGDEALAVLKFVQSSSLSSAAFTVV
Download sequence
Identical sequences A0A1Z4KH32 Q8YTQ9
WP_010996810.1.33676 gi|17230146|ref|NP_486694.1| 103690.all2654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]