SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17230197|ref|NP_486745.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17230197|ref|NP_486745.1|
Domain Number 1 Region: 7-46
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000318
Family Rho termination factor, N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17230197|ref|NP_486745.1|
Sequence length 416
Comment hypothetical protein all2705 [Nostoc sp. PCC 7120]
Sequence
MAKERPPLEEMTLRQLRRVASEFSISRYSRMRKSQLLAAIQEVQRNKALLNPSRSLEAQE
TVEAAKFELGQEDRTGGSLADVDEGLADLPGGYGDSRIVLLPRDPQWAYAYWDIPNDHKE
ELRRQGGQQLALRIYDVTDVNLEYQSPHSIQEYPADELAREWYLPIPVSDRDYVLDIGYR
AVDGRWLVLARSARVHIPPVYPSDWIEDVFISVNFEEDLRGKTLYELVPPAKKAPTVAAG
ANGSNPIYDHIFGLAESAEAQRVAGSLFGSQQHVAGSVRPEQAISSYIFPSGVGMWAVPT
TSGLNMSGVGMSGVGFSASAIPVRPRQFWLIADAELIVYGATEPDATVTIGGRPIKLNPD
GTFRFQMSFQDGLIDYPILAVAADGEQTRSIHMKFNRETPSRNTNTKEEAVVEWLA
Download sequence
Identical sequences A0A1Z4KH66 Q8YTL2
WP_010996858.1.33676 gi|17230197|ref|NP_486745.1| 103690.all2705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]