SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17230270|ref|NP_486818.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|17230270|ref|NP_486818.1|
Domain Number - Region: 97-165
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00765
Family HNH-motif 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17230270|ref|NP_486818.1|
Sequence length 339
Comment hypothetical protein all2778 [Nostoc sp. PCC 7120]
Sequence
MINQLTNEQESLITVYREKWRNIALLTQRIKREKAIKAADLAYSLLGKSIPKIIFLESPN
QFNNNFLKIDAHNLIEQSLVKQVQVKINLPLKEKINSQINTEIFKKVRGKIYYPFGGISK
RLLMSISENQFLSWDDLNLITGWVYYATYIDYCISVLGCEYHHHLWEFWLALANECPWFF
PYNHVCIICDRPLHIRFDNQNQLHAEGEPAVEFADGYSIYSYHGITLPEKYGKLHPQQWE
PQWLLTETNAELRRVLIQGIGYARICQELQAVELDSWAEYTLVQIDNSIDVEPIYLLKMT
CPSTGFIHVLRVPPQTKSAREAICWINWGTDPETFFVET
Download sequence
Identical sequences A0A1Z4KHF7 Q7DL92 Q9WX36
WP_010996929.1.33676 gi|17230270|ref|NP_486818.1| 103690.all2778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]