SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17230316|ref|NP_486864.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17230316|ref|NP_486864.1|
Domain Number 1 Region: 470-676
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 1.26e-26
Family Protein prenylyltransferase 0.031
Further Details:      
 
Domain Number 2 Region: 83-304
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-18
Family Protein kinases, catalytic subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17230316|ref|NP_486864.1|
Sequence length 732
Comment hypothetical protein alr2824 [Nostoc sp. PCC 7120]
Sequence
MKVLRYLPQEEIISLSVSLGRGGEACIYAVPSAGDCVAKIYHKPTVAHASKLRAMLANPP
ENPTASLGHISIAWPQELLWGADESERVIGFLMPRIRGMRPIIDFYNPRTRRQHCPLFNY
QYLLRTARNLAAAFAALHNSGYSVGDVNESNILVSDTALVTLVDTDSFQVCDPDNDIVYR
CPVGKPEFTPPELQNKIFAHHDRQPTHDLFGLGVLIFQLLMEGTHPFSGIYQGIPEPPPY
EARIASGHFTYSKKRQVPYIPTPIAPPWEILHPSLQALFIRCFEDGHNEPQLRPNAQAWL
SAIAEAEDSLTTCTVNSQHHYSNHLHSCPWCERALRLGGRDPFPSVQAIENREHLRPRIP
TKRRYGHSHQPANLPQPVMPMYQSNWHSPTPSFSPYRNRWKGKFYPVVFCLLGFGVLGYL
DVVTKFTSPLVSRNNYAQQALMPQQASGNIALSFAEYYKQGHAAYQVRDYKQAVDNFTHA
IQQESANARVLVNRGNARYNLKDYEGALADYTAALQINPREIKAFVNRGNSRLMLAEYSN
DPDQQYRLAITDFNHALKLNEKEAEAYIRRGIVRTQMAKYSSDTIKDYQEAITDFDQALK
LNPAKTEAYFQRASVRYLIAQYTGDSTKEYDQAIADFDQALKINDKLAKVYLKRGMVRYE
LAQITSNKSDVNNAKALADLQLAAKLSLEQEDTESYQQALSSICIIEESKCNALFQSSTM
RGYASTDLIAKQ
Download sequence
Identical sequences Q8YTA0
WP_010996975.1.33676 103690.alr2824 gi|17230316|ref|NP_486864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]