SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17230338|ref|NP_486886.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17230338|ref|NP_486886.1|
Domain Number 1 Region: 26-218
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.2e-55
Family Class I glutamine amidotransferases (GAT) 0.00000594
Further Details:      
 
Domain Number 2 Region: 203-461
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.6e-54
Family N-type ATP pyrophosphatases 0.00000317
Further Details:      
 
Domain Number 3 Region: 420-540
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 7.72e-53
Family GMP synthetase C-terminal dimerisation domain 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17230338|ref|NP_486886.1|
Sequence length 540
Comment GMP synthase [Nostoc sp. PCC 7120]
Sequence
MNTAVTLLTEQAPQPIEEFGQLERQIIIILDFGSQYSELIARRIRETQVYSEVLSYRTPA
EHLRQLNPKGIILSGGPSSVYSDRAPHCDPEIWNLGVPILGVCYGMQLMVNQLGGEVAKA
DRGEYGKASLHIDDPTDLLTNVEDGTTMWMSHGDSVTKMPPGFEVLAHTDNTPCAAVADH
EKKLYGVQFHPEVVHSVGGLALIRNFVYHICECEPTWTTAAFVEEAIREVRAKVGDKRVL
LALSGGVDSSTLAFLMHKAIGDQLTCVFIDQGFMRKYEPERLVKLFQEQFHIPVEYVNAR
DRFLDIMSGVTDPEEKRRRIGHEFIQVFEETSKNLGPFDYLAQGTLYPDVIESADTNVDP
QTGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRSVGLPEEIVQRQPFPG
PGLAIRILGEVTADRLNILRDADLIVRQEINQRGLYNEYWQAFAVLLPIRSVGVMGDQRT
YAYPIVLRIVKSEDGMTADWARVPYDVLEAISNRIVNEVKGVNRVVFDITSKPPGTIEWE
Download sequence
Identical sequences A0A1Z4KHK6 Q8YT80
gi|17230338|ref|NP_486886.1| 103690.all2846 WP_010996997.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]