SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17230610|ref|NP_487158.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|17230610|ref|NP_487158.1|
Domain Number - Region: 329-412
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0115
Family Collagen-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17230610|ref|NP_487158.1|
Sequence length 414
Comment hypothetical protein all3118 [Nostoc sp. PCC 7120]
Sequence
MRSEIMAEQKSKNYWIRLNLALIVSMSSSLVVANYTLPIKALDIPENSGKLIIAKTPDER
QPEAVQQAIEQIPTSLPPATPQQQSKQSIESPIPVRESSNSTDSNPTPQPRESNSAPRIS
TSSNSNPASQPRQINSAPRTSTSSNSNSRQTNSASPQRGRQSITNPGRGRNSTAKISPVS
LSNLPFREINFVDIAFGVLSKGDFQSQGRYFHFYKFEGRENQLLQIRLGGSTDSRRSSNL
SLSPFMFLLDPDNKVILKRGSVGTNSNIKDAFVFVRLPVKGTYTIAVTSRNPSDTGRYSL
ALRNDRASYILDESAELNAQSSTIKQNRSAYNVSQFQGKKNQLVSIRADSINEEFSPYIV
LLNSQGKTIAADNDQDGLYSALIDRARLPEDDTYYIVVTSNNPNNRGTYRLTLF
Download sequence
Identical sequences Q8YSG7
103690.all3118 gi|17230610|ref|NP_487158.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]