SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17230688|ref|NP_487236.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17230688|ref|NP_487236.1|
Domain Number 1 Region: 4-73
Classification Level Classification E-value
Superfamily YggU-like 3.92e-23
Family YggU-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17230688|ref|NP_487236.1|
Sequence length 75
Comment hypothetical protein asl3196 [Nostoc sp. PCC 7120]
Sequence
MQKRVKVKPNSKQQKIAEQDDGSLTVHLKSPPVDGKANEELIKLLAEKFDVPKSHITIKS
GLSSKQKLIEIETDI
Download sequence
Identical sequences A0A1Z4KIL5 Q8YS95
gi|17230688|ref|NP_487236.1| 103690.asl3196 WP_010997347.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]