SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17230920|ref|NP_487468.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17230920|ref|NP_487468.1|
Domain Number 1 Region: 2-115
Classification Level Classification E-value
Superfamily Ribosomal protein L20 1.7e-51
Family Ribosomal protein L20 0.000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17230920|ref|NP_487468.1|
Sequence length 118
Comment 50S ribosomal protein L20 [Nostoc sp. PCC 7120]
Sequence
MTRVKRGNVARKRRNKILKLAKGFRGSHSTLFRTANQQVMKALRSAYRDRKKKKRDFRRL
WITRINAASRQHGLSYSQLIGNLKKADIQLNRKMLAQLAVLDPASFGKVAELASQAKG
Download sequence
Identical sequences A0A1Z4KJD2 B2J0D0 Q8YRL8
gi|186685029|ref|YP_001868225.1| gi|17230920|ref|NP_487468.1| WP_010997578.1.33676 WP_010997578.1.44837 103690.alr3428 63737.Npun_R4937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]