SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|17231086|ref|NP_487634.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17231086|ref|NP_487634.1|
Domain Number 1 Region: 10-130
Classification Level Classification E-value
Superfamily CheY-like 1.85e-28
Family CheY-related 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17231086|ref|NP_487634.1|
Sequence length 138
Comment two-component response regulator [Nostoc sp. PCC 7120]
Sequence
MLMFSCESSTLKVLVVDDHELTRLTLQLAFSSQENIQVVGLASNGQEAIEMVRDSHPDVI
VLDLQMPVMDGWSASGHIKAISPNTQILAYSSVEDTNLPDTKITSNFDDVCKKDVPTKEL
IALVRELGRRGGDSSISK
Download sequence
Identical sequences Q8YR56
103690.alr3594 WP_010997743.1.33676 gi|17231086|ref|NP_487634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]