SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17231240|ref|NP_487788.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17231240|ref|NP_487788.1|
Domain Number 1 Region: 26-255
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 3.92e-51
Family Isochorismatase-like hydrolases 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17231240|ref|NP_487788.1|
Sequence length 264
Comment hypothetical protein all3748 [Nostoc sp. PCC 7120]
Sequence
MDQSLRTLGVAPNAWMVNQAIADITRPQKTPQPVILSTETKTLRLDLAKTAILVIDMQND
FCHPDGWLAHIGVDVTPATKPIVPLNNLLPELRAVGVPVIWLNWGNRPDLLNISANLLHV
YNPTGEGVGLGDRLPKNDAKVLMAGSWAAAVVDGLQQFPEDICVDKYRMSGFWDTPLDSI
LKNLGITTILFAGVNADQCVLTTLCDANFLGYDCILVKDCTATTSPDYCWLATLYNVKQC
FGFVSDSQAIFTALNHPEATGRDK
Download sequence
Identical sequences A0A1Z4KKC3 Q8YQS1
gi|17231240|ref|NP_487788.1| 103690.all3748 WP_010997889.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]