SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17231307|ref|NP_487855.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17231307|ref|NP_487855.1|
Domain Number 1 Region: 560-822
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.38e-43
Family Calpain large subunit, catalytic domain (domain II) 0.0018
Further Details:      
 
Domain Number 2 Region: 7-118
Classification Level Classification E-value
Superfamily Collagen-binding domain 3.27e-18
Family Collagen-binding domain 0.0037
Further Details:      
 
Domain Number 3 Region: 241-347
Classification Level Classification E-value
Superfamily Collagen-binding domain 3.53e-18
Family Collagen-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17231307|ref|NP_487855.1|
Sequence length 829
Comment hypothetical protein alr3815 [Nostoc sp. PCC 7120]
Sequence
MTLDNAGNTLTTAKKLSVSSNIQTFADRVDSTDPNDFYSFSLSARSSLNIAVDGLSANAD
LQLIRDTNSNGLVDSGEVISGSNKTGRSSESIRRTLDAGNYFIRVYSNTGDTNYNLKVFE
NFAPTALEFKLNDSSLKATDTLSINSGWVSDSNGVSDLSKVDFRIQRANGSWIDVADATK
FTVDPNNTNKASFSHNLSLNSLNLAAGAYTLQGIAYDKTGATSNTVRLGLTIENPELTLT
NAKKITLSAKTQTFADRVDSTNINDFYSFSLSARGNLNLVVDGLSANADVQIIRDSNSNG
LFDGGEVVTGAYKTGSGSESIRRTLDAGNYFIRVYSQSGNTNYNLKVFENFAPTALDFKL
NNTSLKPTDTLSINSAWVSDSNGASDLSKVDFRIQRADGSWINVADTTKFTPDSSNANKA
SFSYSLSLSSLNLAVGTYTLQGIAYDKTGAASNTVNQTFTVTTTPTTTTPITTTPTTVQD
WFSQNLLDQQLITLTRNLASDGNLSRQDMLDIFRNVQDDSKVDANEVKDLRTLVGASTRF
SMQDPVKWLSTQVANGAFVDMAASNFESSLVGRWFLGTIAPTPVFNGKTLTYTTVTGNLF
GSASEARIGDIDQGGLGDCAFLAALGATFGRQFNDAGNTSSSVINSMITDNGDNTYTMRF
YQNGVAEYVTVDRRIATSISAKRNDGVIWVALVEKAYAQWREWRENTPGYNLIGNGDTLN
RPLGFITGQASTYVSSSSTNLYSAIETALANGRAVATARISSTDSLAIGGHAYSVTNVYT
NSSGEKRFVVRNPWGVDGRSVRGANDGFIDVSLDEFKQSFNYGVSIVSA
Download sequence
Identical sequences A0A1Z4KKE8 Q8YQK8
103690.alr3815 WP_010997956.1.33676 gi|17231307|ref|NP_487855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]