SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17231527|ref|NP_488075.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17231527|ref|NP_488075.1|
Domain Number 1 Region: 661-766,798-1166
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 2.56e-137
Family B12-dependent (class II) ribonucleotide reductase 0.00058
Further Details:      
 
Domain Number 2 Region: 3-275
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 3.36e-83
Family B12-dependent (class II) ribonucleotide reductase 0.00025
Further Details:      
 
Domain Number 3 Region: 276-365,399-415,621-682
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.62e-29
Family Intein (protein splicing domain) 0.023
Further Details:      
 
Domain Number 4 Region: 496-594
Classification Level Classification E-value
Superfamily Homing endonucleases 2.34e-17
Family Intein endonuclease 0.031
Further Details:      
 
Weak hits

Sequence:  gi|17231527|ref|NP_488075.1|
Domain Number - Region: 404-450
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0491
Family Group I mobile intron endonuclease 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17231527|ref|NP_488075.1|
Sequence length 1172
Comment hypothetical protein all4035 [Nostoc sp. PCC 7120]
Sequence
MVRELERKRQSARFPESAPAANPVFFRTYSRRTEAGLRETWDEVCDRTLKDLIELGKLSP
EEVAILDKTQRNLTALPSGRWLWVGGTDWINKSKNFSGAYNCTSTNLQDWKAFGLMMNLA
MMGCGTGAVIEPEYINQLPPIRNHLNIIVKGEIGTTPKHLRREYTQTHIEGNSATIYVGD
SREGWVESYQALLELSTDERFTDEVQVFVDVSDVRQSGETLNGFGGVANPVKLPGLYQRC
AAILNKALGRKLNSVECCLLIDEGAVTIVAGNIRRCLPEDALVHTAKGLVPIRDVQVGDL
VQTPLGFRRVVDKFDQGFQDVYEIETNATYPRATLNHRQAVLEDAKGGIVWKHIASLEAG
DRLLHNKQVLPGTVTHLPADFTESRPSHSRTAKSFVVPELTAEVAWLIGFTHGDGYVALG
RNKYDKPYGRVEWSMNSLDAEVTSRIQAKIDAALALFGLSAVHSITKGENTAKSICSSIR
LAEYFHRHIKQPNIPLTVPSFILQGSVDIRAAYLAGLMDSDGAVNNRPPHLITSVYRSFI
RQVSVVLSSLGIAGRLTTTYPQNSNWQVKYNLTIPALKERYNALISPHSAKGELRQGLKM
YGFTVPGAVMRETYTYSEMREMGFQGSRTVDANYERYVAEADISLDIPVTVKGLGSYDHV
QTYDIEVDEAHCFYCDGYLTHNSAGMRQFISDDQLGAAAKDNLWQQDENGRWRIDPERDS
LRMANHTRVFHRKPTLEECVDAVRKQYYSGEGAIQWAGEAVARANIDLLPTQALKVEFLK
AYEQGTAKDWLQKRHPHFDEKELKHRLARYALNPCGEIIGSNFHCNLSEIHLNQIDPFNY
KEQEEAFTAGALSVATLLNHKFPEPRYQYSRELDPIVGVSFTGLFDFFVHAFGAEWLQWW
EAGRPATPQGLAFKREEEKYLSSWREIVQRVVWDYCDRHNIKRPNRCTTVQPSGTKSLLT
GASPGWHPPKAQRFIRRITFRKNDPVALACIDYGYNVIPSQSDKDEQGNLLNDPLDPRVS
EWLVEIPVAVSWADIPGADTIDISKFNAIAQMDFYMQVQKFYVTHNTSATIEVREHEVET
LGTQIWQAIQNDEGYISAALLARFDDHQTFPRLPFEPISKEQYEQMVKEVVQRRKTDDFY
AVLSRYDFGDLMEVGPAGCDSDKCMMPEQSPN
Download sequence
Identical sequences A0A1Z4KL15 Q8YQ05
103690.all4035 WP_010998175.1.33676 gi|17231527|ref|NP_488075.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]