SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17232654|ref|NP_489202.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|17232654|ref|NP_489202.1|
Domain Number - Region: 49-116,179-213,247-326
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 0.000118
Family Isochorismatase-like hydrolases 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17232654|ref|NP_489202.1|
Sequence length 343
Comment hypothetical protein alr5162 [Nostoc sp. PCC 7120]
Sequence
MQLPIPPHFNSAKVGEVWRVPYQERAAEAEAWAKQHNIQPAAFDKIRICLLLIDVQNTFC
IPEFELFVGGESGTGAVDDNRRICEFIYHNLGLITKIIPTLDTHTATQIFHPIFWVNESS
EHPTPAATSITLTDIEKGIWKVNPDVANSITHGDYELLEKHAYHYVKQLSQDGKYPLTVW
PYHSMLGGIGHALVSAVEEAIFFHGIARHSQTQFEIKGDNPLTENYSVLRPEVLIGFDEN
PLADKNQKLIKQLLEFDAVIIAGQAKSHCVAWTIDDLLTEIQQVDTALAKKVYLLEDASS
PVVVPGVVDYTEQADAAFAKFQAAGMQIVKSTESIDKWLQETT
Download sequence
Identical sequences A0A1Z4KP36 Q8YLY4
gi|17232654|ref|NP_489202.1| WP_010999286.1.33676 103690.alr5162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]