SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17233099|ref|NP_490189.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17233099|ref|NP_490189.1|
Domain Number 1 Region: 61-140
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 0.00000000000000349
Family ParB-like nuclease domain 0.0081
Further Details:      
 
Weak hits

Sequence:  gi|17233099|ref|NP_490189.1|
Domain Number - Region: 241-314
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0183
Family KorB DNA-binding domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|17233099|ref|NP_490189.1|
Sequence length 372
Comment ParB family chromosome partitioning protein [Nostoc sp. PCC 7120]
Sequence
MARALPQISEKFKGAVQKTDQEKKIAQLQAEIEQLRVKQSPELEAELQLLREKLKNSSGE
VEIELELIDPNPHQPRQTITLESIQAKARLLKKHGQITPIILVAQEDGRYILLDGQLRTE
GAKLLGWKSIRAVVVPMPKDLTQSSLITFLGFEDLNPLDKAEAVIQEVIKATALSSEEIT
TALATVLKRIERDSNIKELAKLTSLDVDEQKQGLESLGIIGEEQNLFLSLLELGLNPASV
KSNLIPMLFLPADLKNAIRQKGLKGAHALALSTLSAKALETSEEKALKERTRITQKVLAE
NLTVPETRELIKKVKAEYITKTESESKEVKFLIQKINSISEKTLVGASNKQLQELKTLLQ
QKLLEIENLNQK
Download sequence
Identical sequences A0A1Z4KUM9 Q8YL52
gi|17233099|ref|NP_490189.1| 103690.alr7083 WP_010999643.1.33676 gi|17233099|ref|NP_490189.1|NC_003276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]