SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17233133|ref|NP_490223.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|17233133|ref|NP_490223.1|
Domain Number - Region: 50-73
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00153
Family Intron-encoded homing endonucleases 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|17233133|ref|NP_490223.1|
Sequence length 102
Comment hypothetical protein all7117 [Nostoc sp. PCC 7120]
Sequence
MIQGKYPDNWKQLATALKAASNWRCSKCGRVCLRPGEKPDNLTFSERKAHTLQVHHWNRD
PSDNRLENLVCLCSGCHLSYHRFGRGNVSPGQLSLFAEQKVS
Download sequence
Identical sequences A0A1Z4KUJ5 Q8YL21
WP_010999674.1.33676 gi|17233133|ref|NP_490223.1|NC_003276 gi|17233133|ref|NP_490223.1| 103690.all7117 NsR198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]