SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62946459|ref|YP_227663.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62946459|ref|YP_227663.1|
Domain Number 1 Region: 39-273
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 7.06e-75
Family DNA/RNA non-specific endonuclease 0.00000000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62946459|ref|YP_227663.1|
Sequence length 274
Comment sugar-non-specific nuclease [Nostoc sp. PCC 7120]
Sequence
MGICGKLGVAALVALIVGCSPVQSQVPPLTELSPSISVHLLLGNPSGATPTKLTPDNYLM
VKNQYALSYNNSKGTANWVAWQLNSSWLGNAERQDNFRPDKTLPAGWVRVTPSMYSGSGY
DRGHIAPSADRTKTTEDNAATFLMTNMMPQTPDNNRNTWGNLEDYCRELVSQGKELYIVA
GPNGSLGKPLKGKVTVPKSTWKIVVVLDSPGSGLEGITANTRVIAVNIPNDPELNNDWRA
YKVSVDELESLTGYDFLSNVSPNIQTSIESKVDN
Download sequence
Identical sequences A0A1W5CCY9 A0A1Z4KV75 P38446 Q3M1U0
gi|75812616|ref|YP_320235.1| gi|62946459|ref|YP_227663.1| WP_010999911.1.33676 103690.all7362 240292.Ava_B0336 gi|62946459|ref|YP_227663.1|NC_003276 gi|75812616|ref|YP_320235.1|NC_007410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]