SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|17231504|ref|NP_488052.1| from Nostoc sp. PCC 7120

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|17231504|ref|NP_488052.1|
Domain Number 1 Region: 3-124
Classification Level Classification E-value
Superfamily YjgF-like 1.49e-47
Family Chorismate mutase 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|17231504|ref|NP_488052.1|
Sequence length 137
Comment chorismate mutase [Nostoc sp. PCC 7120]
Sequence
MEWRLRAIRGATTVSGNSVEAIREAVSELLDELERRNQLQPQDMISVTFSVTRDLDAIFP
AAIARPRPGWDNVAMLDVQQMHVEGSLQRCIRFLIHAYQPTSVPVHHIYLREARKLRPDW
SLPQALQAPQQIVESRV
Download sequence
Identical sequences A0A1Z4KKZ2 Q8YQ24
WP_010998152.1.33676 103690.all4012 gi|17231504|ref|NP_488052.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]