SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76800685|ref|YP_325693.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76800685|ref|YP_325693.1|
Domain Number 1 Region: 235-490
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 3.75e-62
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000234
Further Details:      
 
Domain Number 2 Region: 17-188
Classification Level Classification E-value
Superfamily Globin-like 2.64e-35
Family Globins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76800685|ref|YP_325693.1|
Sequence length 492
Comment transducer protein hemAT [Natronomonas pharaonis DSM 2160]
Sequence
MSRGMSAKVTDEARGALDGSQLTDDIGIDADEIEWRKEFTRFDEDDAETLAEHAGTFERI
ADDLVEDFYDHLQSHPETVDVIDSSTKSVEMLKETQREYLLNLADGDYGQSYFDRRARVG
KIHDMLDLGPKAYLGAYTIYYEGIADAIADDIKSEFDGDEAAAAVDEAFDRMSSVLKAMN
LDQQVAMDTYIHSYSERLEEEVEKCTQLQQDVTEEVQAPIEELKSVTDRIVDSSDEIATL
ADDQAESAREVANEVGSLSATVEEVASTTDDVATQSAEADELATEGRASAEEAIETMGSV
TDAAESVTEDVETLHDRVGQIDEIVDVIDDIADQTNILALNASIEAARAGEAGDGFGVVA
DEVKSLAEKSQEQASRIDEMVSEIQDDAAGTVENLDETNTAIDDSVTEVRDVLAALEDIE
MAVEGASDGIHEVSRAMDEQAASTEQIAGVVDELADRSERLTDELDEISAANRDQKRSVD
DIVAAVKRLTDD
Download sequence
Identical sequences A0A1U7ETB0
gi|76800685|ref|YP_325693.1| 348780.NP0060A WP_011321760.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]