SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76800931|ref|YP_325939.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76800931|ref|YP_325939.1|
Domain Number 1 Region: 5-208
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.34e-71
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000947
Further Details:      
 
Domain Number 2 Region: 193-326
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.88e-40
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000554
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76800931|ref|YP_325939.1|
Sequence length 329
Comment 2-oxoacid dehydrogenase E1 component, beta subunit [Natronomonas pharaonis DSM 2160]
Sequence
MSTETQSLTLVQAVRDGLKSEMERDEDVLVLGEDVGKNGGVFRATEGLYDEFGEDRVIDT
PLAESGIIGSAIGMAAYGLRPVPEIQFSGFMYPGFDQLVSHAARLRTRSRGDFTCPMVLR
APYGGGIRAPEHHSESKEAFYTHEAGLKVVIPSTPYDTKGLLASAIRDPDPVVFLEPKLI
YRAFREDVPEEPYTVPLGEAAVRRDGTDLSVFTWGAMVRPTLSAAESVAEDGIDVEVVDM
RTLSPMDRETIVESFKKTGRAVVVHEAPKTGGLAGEITATIQEEALYYQEAPVNRVTGFD
VPYPLYALEDYYMPEDTRIEDAIRETYEA
Download sequence
Identical sequences A0A1U7ETW1
WP_011322006.1.57290 gi|76800931|ref|YP_325939.1| 348780.NP0558A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]