SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76800932|ref|YP_325940.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76800932|ref|YP_325940.1|
Domain Number 1 Region: 10-369
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.43e-105
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.000000567
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|76800932|ref|YP_325940.1|
Sequence length 374
Comment 2-oxoacid dehydrogenase E1 component, alpha subunit 1 [Natronomonas pharaonis DSM 2160]
Sequence
MSTLQRDPRDRVQVLDEDGQVVAEDGVPDIDDETLLEMYRTMRLARHFDERAVSLQRQGR
MGTFPPMSGQEAAQVGSALALDADDWVFPSYREHAAAYVRGIDLDQTLQYWMGDERGSQT
AAANVFPVAVPIATQVLHATGVAWAADLKGDDIVSLCYFGDGATSEGDFHEGLNFAGVFD
LPAVFFCNNNQWAISVPREQQSASATLAQKAHAYGFEGVLVDGMDPLAVYKVTREAVEKA
HAADPSRDDAPGRACRPTLIEAIQYRFGAHTTADDPSVYRDDDEVERWKQKDPIPRLELF
LRDRGLLDDERVAAIEQSVTDEVADAVEAAESTERPAPDSMFDNVYADRPPELDAQQRQL
DRLRNRYGDEELLE
Download sequence
Identical sequences A0A1U7ETV5
gi|76800932|ref|YP_325940.1| 348780.NP0560A WP_011322007.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]