SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76801268|ref|YP_326276.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801268|ref|YP_326276.1|
Domain Number 1 Region: 196-463
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.96e-66
Family PFOR Pyr module 0.07
Further Details:      
 
Domain Number 2 Region: 5-221
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.35e-37
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0046
Further Details:      
 
Domain Number 3 Region: 472-581
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000003
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76801268|ref|YP_326276.1|
Sequence length 587
Comment oxoglutarate--ferredoxin oxidoreductase, alpha subunit [Natronomonas pharaonis DSM 2160]
Sequence
MPEDLNWAVGGEAGDGIDSTGKIFAQALSRAGRHVFTSKDFASRIRGGYTAYKVRTSVDR
VESVVDRLDILIALTQRTVDENLDELHEDSIIIYDGERSMMSDFEAPGEMTGLDVPLKAL
AEDAGGAIMRNIVALGAACEVADFNIEYLDESLEKRFGGKGEAIVDNNKEAARLGAEYVR
EEYDLSTPYDLETTDNDYVLLNGDEAIGMGAIAGGCRFYAGYPITPATDVMEYLKGRVEN
YGGVVVQAEDELSAINMALGAARAGARSMTATSGPGIDLMAETFGLVATSETPLVICNVM
RSGPSTGMPTKQEQGDLTAMLHGGHGEVPRFVLAPTNISECFHKTVEAFNLAEKYQLPVY
LTADLSLAVTEQTFEPEEFDMDAVEIDRGKVVDEDNIDEWTNQKGQFQPHAITDDGISPR
AFPGTEDGAHMSTGLEHDELGRRTEDTEMRVKQVDKRDRKVETAIEREDFDYREYGDADA
DTLVISWGSNEGAMREAIGYLDEEDLDVRFISVPYIFPRPDLSEEIDAADDVIVVECNAT
GQFADLIEHDALTRVERINKYNGVRFKADELAEDIKAALGETAEVEA
Download sequence
Identical sequences A0A1U7EUQ7
348780.NP1232A gi|76801268|ref|YP_326276.1| WP_011322343.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]