SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76801362|ref|YP_326370.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801362|ref|YP_326370.1|
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Globin-like 5.4e-35
Family Truncated hemoglobin 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|76801362|ref|YP_326370.1|
Sequence length 119
Comment hypothetical protein NP1422A [Natronomonas pharaonis DSM 2160]
Sequence
MTETLYERLGGKESIAAVVDRFYDRMLDDERVSHHFEEVDMQQQRAQQTLFLCSLTGGPV
EYTGEDMEPAHDHLGITEAEFDVTVDHLEAALEAFDVPERERTEVLEAVAGFRADIVSA
Download sequence
Identical sequences A0A1U7EUY5
WP_011322437.1.57290 gi|76801362|ref|YP_326370.1| 348780.NP1422A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]