SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|76801600|ref|YP_326608.1| from Natronomonas pharaonis DSM 2160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|76801600|ref|YP_326608.1|
Domain Number 1 Region: 6-186
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.75e-39
Family Pyruvate oxidase and decarboxylase Pyr module 0.00036
Further Details:      
 
Domain Number 2 Region: 394-562
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.86e-31
Family Pyruvate oxidase and decarboxylase PP module 0.0017
Further Details:      
 
Domain Number 3 Region: 166-363
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.05e-23
Family Pyruvate oxidase and decarboxylase, middle domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|76801600|ref|YP_326608.1|
Sequence length 564
Comment thiamine pyrophosphate-requiring enzyme (acetolactate synthase 2, large subunit 2; benzoylformate decarboxylase ) [Natronomonas pharaonis DSM 2160]
Sequence
MAESDTGAELFVDALESYGVEHIFGNPGTTELPVLDAISESDIEYILGLQEDIATGMAAG
YASTRRYHAEDDADICPVGVVNLHVTPGLAHGLGNVFGAMYSGAPVVVTAGNHELDFRHE
EPILTGDLEAMVEQFCKFSAEVTHVDSLPMLLRRAVRTALTPPTGPVFLALPADVMMAET
DADPEPLGPIPDAGGGDPNQIATAADYFVEADQPVLVLGDHVARAGRDAVEAAVELAEAT
GARVHGEILASEINFPTDHDQWVSFIGPDESIASMLMDTDTLGLVGCSTNTTLLRHESPL
IDADTTTVQVSSDPDEVGKNHPADAAVIGDPGRIMRAIAERVDKRLDDDEQAARIDHVET
MKASLEPTMQSLGEDETPPGDTRSSKAELVDTMAAVEEDVFIVDEGVTSKFALLTRFPLD
VQGYLSNKGGGLGYGLPAAVGAALAESLRDDPQEVVGYIGDGSYLYYPNSIYSATRYDLD
LTVVVPDNRNYRILKDNTVAMMGGDESDYDFVGMDFDPHVDIPKNAESHGARGHLAETPE
EFEDIYAEALDSSGTDVIDVLVHD
Download sequence
Identical sequences A0A1U7EVI2
348780.NP1904A gi|76801600|ref|YP_326608.1| WP_011322675.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]